General Information

  • ID:  hor005685
  • Uniprot ID:  P10631
  • Protein name:  Peptide YY
  • Gene name:  Pyy
  • Organism:  Rattus norvegicus (Rat)
  • Family:  NPY family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0001664 G protein-coupled receptor binding; GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0031841 neuropeptide Y receptor binding
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0007631 feeding behavior; GO:0032096 negative regulation of response to food; GO:0042755 eating behavior
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  YPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY
  • Length:  36(29-64)
  • Propeptide:  MVAVRRPWPVMVAMLLVLLACLGALVDAYPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRYGKREVPAALFSKLLFTDDSENLPFRSRPEGVDQW
  • Signal peptide:  MVAVRRPWPVMVAMLLVLLACLGALVDA
  • Modification:  T13 Phosphoserine;T36 Tyrosine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  This gut peptide inhibits exocrine pancreatic secretion, has a vasoconstrictory action and inhibitis jejunal and colonic mobility.
  • Mechanism:  NA
  • Cross BBB:  NO
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P10631-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005685_AF2.pdbhor005685_ESM.pdb

Physical Information

Mass: 486613 Formula: C190H287N53O58
Absent amino acids: CFIMW Common amino acids: Y
pI: 7.52 Basic residues: 6
Polar residues: 11 Hydrophobic residues: 9
Hydrophobicity: -109.44 Boman Index: -9960
Half-Life: 2.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: 2 min Aliphatic Index 62.5
Instability Index: 9299.17 Extinction Coefficient cystines: 7450
Absorbance 280nm: 212.86

Literature

  • PubMed ID:  3654598
  • Title:  Peptide YY. Structure of the Precursor and Expression in Exocrine Pancreas.
  • PubMed ID:  1890992
  • Title:  Isolation, Characterization, and Developmental Expression of the Rat peptide-YY Gene.
  • PubMed ID:  3413293
  • Title:  Isolation and sequence of rat peptide YY and neuropeptide Y.